Conus ventricosus clone VnMLCL-05 conotoxin precursor, mRNA, complete cds (N00100) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMLCL-05 conotoxin precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
cgtgtttaccaacagctacgcctgccaaccgatcctttct
ctgcgctacgtggcactttgcagtgtgagaacaagaatct
gactacaagcaca
atgctgtgtcttccggtcttcatcatc
cttcttctgctggcttcacctgcagctccaaaccctttgc
aaacgagaatccaaagcaatttgattcgcgcaggccctga
agatgccaatataaaaactgataaacggatttttgccggc
ttactggcaagcattttgaagcctatcatcgatgcagcta
agggc
tgatggtgactttggaaacgacatctccaaactgt
acccggatatgagatgtaaaaacaggctgtttcttttgca
cttgctcgngngggttgaaacagncgtcaaatatatgttg
ccatttgcattgncgngttctccgttttattcacagaact
gcataccaaattagactaaatgncttggaaactgaactca
ttttctacagagtataggcagngaccccctggngataggt
caattaattccgattatctaaaactgnttcgccatctttt
tgggggggcttttttgggaca
Sequence translation MLCLPVFIILLLLASPAAPNPLQTRIQSNLIRAGPEDANI
KTDKRIFAGLLASILKPIIDAAKG

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded VnMLCL-05 precursor

External links
Ncbi
GenBank AF215000

Tools