Conus litteratus clone 02G08 O superfamily conotoxin precursor analog 1 mRNA, complete cds (N01003) Nucleic Acid Card

General Information
Name Conus litteratus clone 02G08 O superfamily conotoxin precursor analog 1 mRNA, complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
gcaccacgtctgtgtcatccttgcacggtgaatttggctt
catatttctccactgtcttccttcgcatcacctaaaacat
caccaag
atgaagctgacgtgcatgatgatcgttgctgtg
ctgttcttgactgcctggacatttgtcacggctgatgacc
ccagagatggactggaggatagaggaggatgggggcaggc
aggaggatgggggaagcttttctcgaaggcacgtaacgaa
atgaagaaccccaaagcctctaaactggacaatacggaaa
ggcgcatc
taaattggtgaagtttgtgccgtaccgctcgt
tgcatccaacgtatgctggagtggcttatgtgttggcgtc
tgcgcctagttaaactgccgtgatgtcttctactcccctc
tgtgctacccctggcttgatcattgattagcgtgtcccct
tcactggttaagatcctactctgatcctactgtctggaga
cctctgtggtccaacatccaaataaagcgacatcccagaa
aaa
Sequence translation MKLTCMMIVAVLFLTAWTFVTADDPRDGLEDRGGWGQAGG
WGKLFSKARNEMKNPKASKLDNTERRI

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Proteins Encoded Lt0.1 precursor

External links
Ncbi
GenBank DQ345374

Tools