Conus ventricosus clone VnMLCL-042 conotoxin precursor, mRNA, complete cds (N00101) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMLCL-042 conotoxin precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
cgtgtttaccaacagttacgcctgccaaccgatcctttct
ctgcgctacgtgtcactttgcagtgtgagaacaagaatct
gactacaagcaca
atgctgtgtcttccggtcttcatcatc
cttcttctgttggcttcacctgcagctccaaaccctttgc
aaacgagaatccaaagcaatttgattcgcgcaggccctga
agatgccaatatgaaaactgataaacgggttatttccggc
ttattggcgggcatcttggtgcctctcatcgatgcaatta
tgggc
tgatgctgactttggaaacgacatctccaaactgt
acccggatatgagatgtaaaaaaacaggctgtttcttttg
cacatgctcatgtgggttgaaacagtcgtcaaatatacgt
tgccatttgcattgtcatgttctgcttttaatcacagaac
tgcataccagattagactaaaataatgtcttggaaattga
actcattttctacagagtataggcagtgaccaattgatga
tagttcaattaattctgattatctaaaactgcttcaacat
ctttttacgtgtgctttttgtgacat
Sequence translation MLCLPVFIILLLLASPAAPNPLQTRIQSNLIRAGPEDANM
KTDKRVISGLLAGILVPLIDAIMG

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded VnMLCL-042

External links
Ncbi
GenBank AF215001

Tools