Conus litteratus clone 04A04 P superfamily conotoxin lt9a precursor, mRNA, complete cds (N01015) Nucleic Acid Card

General Information
Name Conus litteratus clone 04A04 P superfamily conotoxin lt9a precursor, mRNA, complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
gactaagacatccagtggcgacagacgttgaagatccttg
gcggaaagaagatcgtctcctcatctcgtgctggtttgcc
ctccactcgacttacgaacacttgttcgcttcacatcccc
gcatcgagccagaaaggaaacgctttcagccgttaca
atg
actctgacgaaatcagctgttctgattctggtgctactgt
tggcctttgacaactttgctgacgtccagcctggcctaat
aacaatgggtgggggcagactctctaacctgctgtccaag
agggtcaggatttggttctgtgctagtagaacttgctctg
cacctgcggactgcaacccctgtacctgtgaatccggcgt
gtgcgtggattggcta
tgaagctgactgtctccttcaagt
tcaatcaaagagactttgatttcaatcagtgattgaagtc
tctttggttctatgtcacagggctgacgtcaacgaatcga
tacttggcttgctttctttgacttttgtttccgtgctctc
accattacacgtagcagctgttctttaaccctcgctctga
cacgtgttgtagcttacagtaagcggagagacagtgtcct
gacaggttcctttcgtttctggcttacagagcgtggtcgc
cttaaagctccactccactttgattgcctgttgcttttca
agcagatctaccgtcaaggattatccagaccttttgaaat
ccgcctgagaggttatcttttcactagcccctgttggttt
gcctctgtggttgcgcgaatctggtctccgttcagcaaca
tttagaaaaaaaaa
Sequence translation MTLTKSAVLILVLLLAFDNFADVQPGLITMGGGRLSNLLS
KRVRIWFCASRTCSAPADCNPCTCESGVCVDWL

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Proteins Encoded Lt9a precursor

External links
Ncbi
GenBank DQ345386

Tools