Conus litteratus clone 12E09 conotoxin contulakin lt2 precursor, mRNA, complete cds (N01019) Nucleic Acid Card

General Information
Name Conus litteratus clone 12E09 conotoxin contulakin lt2 precursor, mRNA, complete cds
Organism Conus litteratus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
gagacattcactccacagcgcagtgaccagacgtgtggtg
gttttgtccggggagggaattgatccatcagagcaattgg
agagggaaagcaagcggcaaag
atgcagatggcctactgg
gtgatggtgatgatgatggtggggattacagcccctctgt
ctgaaggtcgtaaattgaacgacgcaattcggggtttggt
gccaaatgacttaaccccacagcttttgcaaagtctggtt
tcccgtcgtcatcgtgtgtttcatcttgacaacacttatc
tcaagatacccatatgtgcctggaaggtatgtccaccaac
cccatggagacgacgtgatcttaagaaaagaaacaaa
tga
cgtcagacaaccgccacaacttgagtacgacattgttaat
gcgacttgagcaaatttttcagcatcactatggttgtaaa
gaaatcagctgctttaaacgattggatctttccttattta
agagttgtattgatgtcagctctgcactctgaaataaagc
tgatgtgacaaaccaaaaaaa
Sequence translation MQMAYWVMVMMMVGITAPLSEGRKLNDAIRGLVPNDLTPQ
LLQSLVSRRHRVFHLDNTYLKIPICAWKVCPPTPWRRRDL
KKRNK

References
Pi,C., Liu,J., Peng,C., Liu,Y., Jiang,X., Zhao,Y., Tang,S., Wang,L., Dong,M., Chen,S. and Xu,A. (2006) Diversity and evolution of conotoxins based on gene expression profiling of Conus litteratus Genomics 88:809-819

Internal links
Proteins Encoded Contulakin-Lt2 precursor

External links
Ncbi
GenBank DQ345390

Tools