Conus ventricosus clone VnMLCL-033 conotoxin precursor, mRNA, complete cds (N00103) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMLCL-033 conotoxin precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
cgtgtttaccaacagttacgcctgccaaccgatcctttct
ctgcgctacgtggcactttgcagtgaatctgactacaagc
aca
atgctgtgtcttccggtcttcatcatccttcttctgt
tggcttcacctgcagctccaaaccctttgcaaacgagaat
ccaaagcaatttgattcgcgcaggccctgaagatgccaat
ataaaaactgataaacgggttatttccggcttattggcga
gcatcttggtgcctctcatcgatgcaattattggc
tgatg
ctgactttggaaacgacatctccaaactgtacccggatat
gagatgtgaaaaacaggctgtttcttttgcacatgctcgt
gtgggttgaaacagtcgtcaaatatacgttgccatttgca
ttgtcatgttctgcttttaatcacataactgcattccaga
ttagactaaaataatgtcttggaaattgaactcattttct
acagagtataggcagtgaccaattgatgatagttcaatta
tttctgattatctaaaactgcttcaacatctttttacgtg
tgctttttgtgacat
Sequence translation MLCLPVFIILLLLASPAAPNPLQTRIQSNLIRAGPEDANI
KTDKRVISGLLASILVPLIDAIIG

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded VnMLCL-033

External links
Ncbi
GenBank AF215003

Tools