Conus quercinus alpha conotoxin Qc1.6 gene, partial cds (N01038) Nucleic Acid Card

General Information
Name Conus quercinus alpha conotoxin Qc1.6 gene, partial cds
Organism Conus quercinus
Organism Diet vermivorous
Organism Clade VII
Organism Region Indo-Pacific
Notes

Sequence
gtggttctgggtccagca
tttgatggcaggaatgctgcag
ccagcgacaaagcttctgagctgatggctctggccgtcag
gggatgctgttccaatcctacctgtgccgggaataatgga
aacatctgtggc
tgaagacgctgatgctccaggaccctct
gaaccacgac
Sequence translation FDGRNAAASDKASELMALAVRGCCSNPTCAGNNGNICG

References
Yuan,D.D., Han,Y.H., Wang,C.G. and Chi,C.W. (2007) From the identification of gene organization of alpha conotoxins to the cloning of novel toxins Toxicon 49:1135-1149
Chang,D. and Duda,T.F. Jr. (2012) Extensive and continuous duplication facilitates rapid evolution and diversification of gene families. Mol. Biol. Evol. 29:2019-2029

Internal links
Proteins Encoded Qc1.6 precursor

External links
Ncbi
GenBank DQ311071, JF723468

Tools