Conus ventricosus clone VnMEKL-0221 conotoxin scaffold VI/VII precursor, mRNA, complete cds (N00104) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMEKL-0221 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet vermivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
gcagacttggtaagaagtaaaaaacctttatc
atggagaa
actgacaatcctgcttcttgttgctgctgtgctgatgtgg
acccaggccctgattcaagaaaaacgcccaaaggagaaga
tcaaatttttatcaaaaagaaagacaactgctgagagttg
gtgggagggcgaatgcagcggttggtccgtgtattgtact
caacactcggagtgttgttctggtgaatgtacaggtaatt
actgcgaattgttt
tgatgaactctgaccacaagccatcc
gacatcgccactctcc
Sequence translation MEKLTILLLVAAVLMWTQALIQEKRPKEKIKFLSKRKTTA
ESWWEGECSGWSVYCTQHSECCSGECTGNYCELF

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Vn6.1 precursor

External links
Ncbi
GenBank AF215004

Tools