Conus achatinus alpha conotoxin Ac4.3b gene, partial cds (N01042) Nucleic Acid Card

General Information
Name Conus achatinus alpha conotoxin Ac4.3b gene, partial cds
Organism Conus achatinus
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
gtggttctgggtccagca
tctgatgtcaggaatgccgcag
tccacgagagacagaaggagctggtcccttcgaaaatcac
gacttgctgtggttatagtccagggacagcgtgcccttct
tgcatgtgcacaaatacctgtaaaaaaaaaaacaaaaaac
caggccgcagaaacgac
tgatgctccaggaccctctgaac
cacgac
Sequence translation SDVRNAAVHERQKELVPSKITTCCGYSPGTACPSCMCTNT
CKKKNKKPGRRND

References
Yuan,D.D., Han,Y.H., Wang,C.G. and Chi,C.W. (2007) From the identification of gene organization of alpha conotoxins to the cloning of novel toxins Toxicon 49:1135-1149

Internal links
Proteins Encoded Ac4.3b precursor

External links
Ncbi
GenBank DQ311075

Tools