Conus pulicarius alpha conotoxin Pu1.2 gene, partial cds (N01045) Nucleic Acid Card

General Information
Name Conus pulicarius alpha conotoxin Pu1.2 gene, partial cds
Organism Conus pulicarius
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
gtggttctgggtccagca
ttggatggcaggaatgctgcag
ccgacttcgaaacgtctgacctgctggctatgaccataag
ggggggatgctgttcctatcctccctgtatcgccaataat
cctctctgtggtggaaaacgc
tgatggtccaggaccctct
gaaccacgac
Sequence translation LDGRNAAADFETSDLLAMTIRGGCCSYPPCIANNPLCGGK
R

References
Yuan,D.D., Han,Y.H., Wang,C.G. and Chi,C.W. (2007) From the identification of gene organization of alpha conotoxins to the cloning of novel toxins Toxicon 49:1135-1149

Internal links
Proteins Encoded Pu1.2 precursor

External links
Ncbi
GenBank DQ311078

Tools