Conus leopardus conotoxin Lp1.6b mRNA, partial cds (N01051) Nucleic Acid Card

General Information
Name Conus leopardus conotoxin Lp1.6b mRNA, partial cds
Organism Conus leopardus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
gtggttctgggtccagcatctgatggcaggaatgctgcag
ccaacaacaaagcttctgacctgatcaggcaaatctgctg
tggctatggtgactgtggcttcgttccaaacgtttgtgtc

tga
Sequence translation VVLGPASDGRNAAANNKASDLIRQICCGYGDCGFVPNVCV

References
Yuan,D.D., Han,Y.H., Wang,C.G. and Chi,C.W. (2007) From the identification of gene organization of alpha conotoxins to the cloning of novel toxins Toxicon 49:1135-1149

Internal links
Proteins Encoded Lp1.6b precursor

External links
Ncbi
GenBank DQ359143

Tools