Conus ferrugineus conotoxin fe14.2 precursor, mRNA, complete cds (N01060) Nucleic Acid Card

General Information
Name Conus ferrugineus conotoxin fe14.2 precursor, mRNA, complete cds
Organism Conus ferrugineus
Organism Diet vermivorous
Organism Clade IX
Organism Region Indo-Pacific
Notes

Sequence
atgccgtctgttcggtctgtgacctgctgctgtctgctgt
ggatgatgctctctgtacagctggttactcctggctcccc
tggaactgcacagctgtctgggcagcgcactgctagaagt
tctgggtcgacagtatgcaagatgatgtgcaggttgggat
acggacacttgtatccctcttgcggatgcagagggaaacg
ggacgtggtttcttcatcgatggcggtg
tga
Sequence translation MPSVRSVTCCCLLWMMLSVQLVTPGSPGTAQLSGQRTARS
SGSTVCKMMCRLGYGHLYPSCGCRGKRDVVSSSMAV

References
Imperial,J.S., Bansal,P.S., Alewood,P.F., Daly,N.L., Craik,D.J., Sporning,A., Terlau,H., Lopez-Vera,E., Bandyopadhyay,P.K. and Olivera,B.M. (2006) A novel conotoxin inhibitor of Kv1.6 channel and nAChR subtypes defines a new superfamily of conotoxins Biochemistry 45:8331-8340

Internal links
Proteins Encoded Fe14.2 precursor

External links
Ncbi
GenBank DQ447645

Tools