Alpha Conotoxin Peptides (N01074) Nucleic Acid Card

General Information
Name Alpha Conotoxin Peptides
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
atgttcaccgtgtttctgttggttgtcttggcaaccactg
tcgtttcctacccttcagatagtgcatctgatggcaggga
tgacgaaaccaaagacgaaaagtctgacatgtacaaatcg
aaacggaatggacgctgttgccatcctgcctgtggcaaac
actttagttgtggacgc
tgatgctgcaggaccctctgaac
cacgacgt
Sequence translation MFTVFLLVVLATTVVSYPSDSASDGRDDETKDEKSDMYKS
KRNGRCCHPACGKHFSCGR

References
Olivera,B.M., Layer,R.T., Watkins,M., Hillyard,D.R., Mcintosh,M.J., Jones,R.M. and Schoenfeld,R. (2003) Alpha Conotoxin Peptides JP 2003525582-A 3 02-SEP-2003

Internal links
Proteins Encoded Bt1.6 precursor

External links
Ncbi
GenBank BD394974

Tools