Conus miliaris isolate M23 four-loop conotoxin preproprotein mRNA, partial cds (N00011) Nucleic Acid Card

General Information
Name Conus miliaris isolate M23 four-loop conotoxin preproprotein mRNA, partial cds
Organism Conus miliaris
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
c
gtgttgatcatcgccgtgctgttcctgacggcctgtcaa
ctcactacagctgtgacttcctccagaggtaagcagaagc
accgtgctctgaggtcaactgacaaaaagttcaaggtggc
cttgctttgctcgcctcccggttcatactgttttggtcct
gctgcctgctgcagcaatttttgcagtaccatgtccgacg
tatgtcaggaaaactggtctggc
tgatattccccttccgt
gatctatcctcttttg
Sequence translation VLIIAVLFLTACQLTTAVTSSRGKQKHRALRSTDKKFKVA
LLCSPPGSYCFGPAACCSNFCSTMSDVCQENWSG

References
Duda,T.F. Jr. (0) Positive selection and patterns of divergence of orthologous toxin genes among related venomous predatory gastropods

Internal links
Proteins Encoded Ml23 precursor

External links
Ncbi
GenBank DQ644547

Tools