Conus ebraeus CebH1-h four-loop conotoxin precursor, mRNA, partial cds (N01159) Nucleic Acid Card

General Information
Name Conus ebraeus CebH1-h four-loop conotoxin precursor, mRNA, partial cds
Organism Conus ebraeus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific,Eastern Pacific
Notes

Sequence
c
gtgttgatcatcgccgtgctgctcctgacggcctgtcaa
ctcactacagctgagacttactccagaggtaggcagaagc
atcgtgctcggaggtcaactgacaaaaactccaagtggac
cagggaatgcacacattccggcggagcctgtaatagtcat
gatcaatgctgcaacgctttttgcgatacggcgaccagga
catgtgtt
taaactcgtggggcgcctgatatttccctttc
gtgatctatcctcttttg
Sequence translation VLIIAVLLLTACQLTTAETYSRGRQKHRARRSTDKNSKWT
RECTHSGGACNSHDQCCNAFCDTATRTCV

References
Duda,T.F. Jr. and Palumbi,S.R. (2000) Evolutionary diversification of multigene families: allelic selection of toxins in predatory cone snails Mol. Biol. Evol. 17:1286-1293

Internal links
Proteins Encoded Eb6.1 precursor

External links
Ncbi
GenBank AF174275

Tools