Sequence 9 from patent US 6077934 (N01176) Nucleic Acid Card

General Information
Name Sequence 9 from patent US 6077934
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atggggaaactgacaatactggttcttgttgctgctgtac
tgttgtcgacccaggtcatggttcaaggtgacgcagatca
acctgcagatcgtgatgcagtgccaagagacgataaccca
agtggaacggatggaaagttcatgaatgttctacgtcggt
ttggatgtccgtggcaaccttggtgtggc
tgatcggaatc
cacgattgctatgacagccaacagtgccgcactgaattac
cctacagtggtctggttgctccagaacaatgatggtttga
aaacgtattcg
Sequence translation MGKLTILVLVAAVLLSTQVMVQGDADQPADRDAVPRDDNP
SGTDGKFMNVLRRFGCPWQPWCG

References
Jacobsen,R., Jimenez,E., Cruz,L.J., Olivera,B.M., Gray,W.R., Grilley,M., Watkins,M. and Hillyard,D.R. (2000) Contryphan peptides Patent: US 6077934 20-JUN-2000

Internal links
Proteins Encoded Contryphan-Sm precursor

External links
Ncbi
GenBank AR099606

Tools