Sequence 21 from patent US 6077934 (N01182) Nucleic Acid Card

General Information
Name Sequence 21 from patent US 6077934
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
ccgtcatctacactctctgtctccctgattgccgccttca
gtcgacccgccctcatccagcgcagacttggtaagaagtg
aagaaccttt
atcatggggaaactgacaatactggttctt
gttgctgctgtcctgttgtcggcccaggtcatggttcaag
gtgacggagatcaacctgcagatcgtaatgcagtgccaag
agacgataacccaggtggagcgagtggaaagttcatgaat
gttctacgtcggtctggatgtccgtgggaaccttggtgt
g
gctgaacggaatccacgattgcaatgacagccgacagagc
cgcactcgaattatctacagtggtgatgtcagagcatgat
gtttgaaaacgatc
Sequence translation IMGKLTILVLVAAVLLSAQVMVQGDGDQPADRNAVPRDDN
PGGASGKFMNVLRRSGCPWEPWC

References
Jacobsen,R., Jimenez,E., Cruz,L.J., Olivera,B.M., Gray,W.R., Grilley,M., Watkins,M. and Hillyard,D.R. (2000) Contryphan peptides Patent: US 6077934 20-JUN-2000

Internal links
Proteins Encoded Sequence 22 from patent US 6077934

External links
Ncbi
GenBank AR099612

Tools