Sequence 13 from patent US 6153738 (N01192) Nucleic Acid Card

General Information
Name Sequence 13 from patent US 6153738
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atggggaaactgacaatactggttcttgttgctgttgcac
tgttgtcgacccaggtcatggttcaaggtgacggagatca
acctgcagatcgtgacgcagtgccaagagacgataatcca
ggtggaatgagtgaaaagttcttgaatgctctgcaaagac
gtggatgtccgtggcaaccttattgtggc
tgatcagaatc
cacgattgctatgacagcc
Sequence translation MGKLTILVLVAVALLSTQVMVQGDGDQPADRDAVPRDDNP
GGMSEKFLNALQRRGCPWQPYCG

References
Jacobsen,R., Jimenez,E., Cruz,L.J., Olivera,B.M., Gray,W.R., Grilley,M., Watkins,M. and Hillyard,D.R. (2000) Contryphan peptides Patent: US 6077934 20-JUN-2000

Internal links
Proteins Encoded Contryphan-Tx precursor

External links
Ncbi
GenBank AR120121

Tools