Sequence 5 from patent US 6489298 (N01208) Nucleic Acid Card

General Information
Name Sequence 5 from patent US 6489298
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgcagacggcctactgggtgatggtgatgatgatggtgt
ggattgcagcccctctgtctgaaggtggtaaactgaacga
tgtaattcggggtttggtgccagacgacataaccccacag
ctcatgttgggaagtctgatttcccgtcgtcaatcggaag
agggtggttcaaatgcaaccaagaaaccctatattctaag
ggccagcgaccaggttgcatctgggcca
tag
Sequence translation MQTAYWVMVMMMVWIAAPLSEGGKLNDVIRGLVPDDITPQ
LMLGSLISRRQSEEGGSNATKKPYILRASDQVASGP

References
Craig,A.G., Griffen,D., Olivera,B.M., Watkins,M., Hillyard,D.R., Imperial,J., Cruz,L.J., Wagstaff,J.D., Layer,R.T., Jones,R.M. and McCabe,R.T. (2002) Contulakin-G, analogs thereof and uses thereof Patent: US 6489298 03-DEC-2002

Internal links
Proteins Encoded contulakin-G precursor

External links
Ncbi
GenBank AR258773

Tools