Conus marmoreus glacontryphan-M mRNA, complete cds (N01212) Nucleic Acid Card

General Information
Name Conus marmoreus glacontryphan-M mRNA, complete cds
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
aacctttatc
atggggaaactgacaatactggttcttgtt
gctgctgtactcttgtcgacccaggtcatggttcaaggtg
acagagatcaacctgcagatcgtaatgcagtgccaagaga
cgataacccaggtagagcgagaagaaagcgcatgaaagtt
ctaaatgagtctgaatgtccgtggcatccttggtgtggc
t
gatcggaatccacgattgctatgacagccgacactgccgc
actcgaattaccctacagt
Sequence translation MGKLTILVLVAAVLLSTQVMVQGDRDQPADRNAVPRDDNP
GRARRKRMKVLNESECPWHPWCG

References
Hansson,K., Ma,X., Eliasson,L., Czerwiec,E., Furie,B., Furie,B.C., Rorsman,P. and Stenflo,J. (2004) The first gamma-carboxyglutamic acid-containing contryphan. A selective L-type calcium ion channel blocker isolated from the venom of Conus marmoreus. J. Biol. Chem. 279:32453-32463

Internal links
Proteins Encoded contryphan-M precursor

External links
Ncbi
GenBank AY485226

Tools