Sequence 5 from patent US 6696408 (N01214) Nucleic Acid Card

General Information
Name Sequence 5 from patent US 6696408
Organism Unknown
Organism Diet
Organism Clade
Organism Region
Notes

Sequence
atgcagacggcctactgggtgatggtgatgatgatggtgt
ggattgcagcccctctgtctgaaggtggtaaactgaacga
tgtaattcggggtttggtgccagacgacataaccccacag
ctcatgttgggaagtctgatttcccgtcgtcaatcggaag
agggtggttcaaatgcaaccaagaaaccctatattctaag
ggccagcgaccaggttgcatctgggcca
tag
Sequence translation MQTAYWVMVMMMVWIAAPLSEGGKLNDVIRGLVPDDITPQ
LMLGSLISRRQSEEGGSNATKKPYILRASDQVASGP

References
Craig,A.G., Griffen,D., Olivera,B.M., Watkins,M., Hillyard,D.R., Imperial,J., Cruz,L.J., Wagstaff,J.D., Layer,R.T., Jones,R.M. and McCabe,R.T. (2004) Contulakin-G, analogs thereof and uses therefor Patent: US 6696408 24-FEB-2004

Internal links
Proteins Encoded contulakin-G precursor

External links
Ncbi
GenBank AR477487

Tools