Conus geographus contulakin-G mRNA, complete cds (N01215) Nucleic Acid Card

General Information
Name Conus geographus contulakin-G mRNA, complete cds
Organism Conus geographus (Geography cone)
Organism Diet piscivorous
Organism Clade II
Organism Region Indo-Pacific
Notes

Sequence
tctggtggttgtggtccagggaagtgatacaggaagtgat
tcatcagagcagttggagaaggaaagcaggcgacaaag
at
gcagacggcctactgggtgatggtgatgatgatggtgtgg
attgcagcccctctgtctgaaggtggtaaactgaacgatg
taattcggggtttggtgccagacgacataaccccacagct
catcttgggaagtctgatttcccgtcgtcaatcggaagag
ggtggttcaaatgcaaccaagaaaccctatattctaaggg
ccagcgaccaggttgcatctgggcca
tagcttgcatcagc
gctcacaacagccagtttctccagttggacgaagacttgt
actgatgtcagctctgcactgtgaaataaagctgatgtga
caaacaaaaaaaaaaaaaaaaaaaaaaaaaaa
Sequence translation MQTAYWVMVMMMVWIAAPLSEGGKLNDVIRGLVPDDITPQ
LILGSLISRRQSEEGGSNATKKPYILRASDQVASGP

References
Craig,A.G., Norberg,T., Griffin,D., Hoeger,C., Akhtar,M., Schmidt,K., Low,W., Dykert,J., Richelson,E., Navarro,V., Mazella,J., Watkins,M., Hillyard,D., Imperial,J., Cruz,L.J. and Olivera,B.M. (1999) Contulakin-G, an O-glycosylated invertebrate neurotensin J. Biol. Chem. 274:13752-13759

Internal links
Proteins Encoded contulakin-G precursor

External links
Ncbi
GenBank AF121108

Tools