Conus betulinus conotoxin bt15a mRNA, complete cds. (N01218) Nucleic Acid Card

General Information
Name Conus betulinus conotoxin bt15a mRNA, complete cds.
Organism Conus betulinus
Organism Diet vermivorous
Organism Clade X
Organism Region Indo-Pacific
Notes

Sequence
ccttcatc
atggagaaacttacaatcctggttcttgttgc
cactgtcctgttggcgatccaggtcctggttcaaagtgat
ggagaaaaacctctgaagaggagggtcaaacaatacgcag
cgaaacgtctctcggcactcatgagagggccacgccaatg
cacacctaggaatcagaggtgtgagggggatgcggaatgt
tgcccaaatcttgtgtgtaaatgctttaccagacctgatt
gccagtctggttataaatgtgatacttca
tgatctcatgc
caccccatatcaatacatcagagccacaacc
Sequence translation MEKLTILVLVATVLLAIQVLVQSDGEKPLKRRVKQYAAKR
LSALMRGPRQCTPRNQRCEGDAECCPNLVCKCFTRPDCQS
GYKCDTS

References
Jiang, X., Pi, C. and Liu, Y. (0) A Novel Class of Conotoxin cDNAs with a Distinctive Cysteine Arrangement Unpublished

Internal links
Proteins Encoded Bt15a precursor

External links
Ncbi
GenBank DQ512965

Tools