Conus emaciatus conotoxin ec15a mRNA, complete cds. (N01219) Nucleic Acid Card

General Information
Name Conus emaciatus conotoxin ec15a mRNA, complete cds.
Organism Conus emaciatus
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
ccttcatc
atggagaaacttacaatcctgattcttgttgc
cactgtcctgttggcgatccaggtcctgggtcaaggtgaa
ggagaaaaacctccgaaggagtgggtccaacaatatgcag
cgaaacgtctctgggcactcatgaaagggccacgccagtg
cacacctaaggatgcgccttgtgatgataataaccaatgc
tgctcaggtcttgagtgtaaatgctttaacatgcctgatt
gccagtctggttctacatgtagagtc
taaatgacctcatg
ccaccccatatcaatacatcagagccacaacc
Sequence translation MEKLTILILVATVLLAIQVLGQGEGEKPPKEWVQQYAAKR
LWALMKGPRQCTPKDAPCDDNNQCCSGLECKCFNMPDCQS
GSTCRV

References
Jiang, X., Pi, C. and Liu, Y. (0) A Novel Class of Conotoxin cDNAs with a Distinctive Cysteine Arrangement Unpublished

Internal links
Proteins Encoded Ec15a precursor

External links
Ncbi
GenBank DQ512966

Tools