Conus coronatus isolate C3 four-loop conotoxin mRNA, partial cds. (N01222) Nucleic Acid Card

General Information
Name Conus coronatus isolate C3 four-loop conotoxin mRNA, partial cds.
Organism Conus coronatus
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
c
gtgatgatcgtcgccgtgctgttcctgacagcctgtcaa
ctcgctacagctgacacttcctccagaggtaagcagaagc
accgtgctctgaggtcaactgacaaaaagttcgcggtgat
cttcacttgcacgcctcccggttcacactgtactggtcat
tctgactgctgcagcgatttttgcagtaccatgtccgacg
tatgtcag
tgaagctggtctggcgtctgatattccccttc
cgtgatctatcctcttttg
Sequence translation VMIVAVLFLTACQLATADTSSRGKQKHRALRSTDKKFAVI
FTCTPPGSHCTGHSDCCSDFCSTMSDVCQ

References
Duda,T.F. Jr. and Remigio,E.A. (2008) Variation and evolution of toxin gene expression patterns of six closely related venomous marine snails. Mol. Ecol. 17:3018-3032

Internal links
Proteins Encoded Co6.1 precursor

External links
Ncbi
GenBank EF108268

Tools