Conus leopardus isolate Leo-T2 conotoxin gene, partial sequence. (N01248) Nucleic Acid Card

General Information
Name Conus leopardus isolate Leo-T2 conotoxin gene, partial sequence.
Organism Conus leopardus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
cacattcttttcacctggacgcgggaaactgacaccaagc
aga
atgcgctgtctcccagtcttcatcattcttccgctgc
tgattccatctgcacctagcgttgatgcccaaccgatgac
cgaagatgatgtgccactggcgtctttccatgagcaaacc
ctacaagaactttggaacaaacgcccgtgctgcccactaa
ttcctgggtgctgtcgt
tgatgatgaagggaaatgacttt
ggatgagacccctgcgaactgtccctggatgtgaaatttg
gaaagcagactgttcctttcgcacgtgttcgtggaatttc
gaatggtcgttaacaacacgctgccacttgcgagctacta
tctctctgtcttttcatctgtggaacttaatgatctaaca
actgaaatgtcattgaaaattttgaatggatcatgtagtc
agtaattacatcatttggacttttcgaaattttttcaaaa
tgtaagtttttcccatggaaaggtcatttgtagttaaata
ttttagtgtgttatgttttgcacacaagcaatagaatgct
gtgcttctttttgttcccacatcaatggtgggggcagaaa
tcatttgttttggccaatgtaattacgacctgcatttagt
gctatagtgattgcatttttagtgttgaatgttttatcta
caaacagaaaaaaaggttgatcgactaataaagacttgca
tgaccaaaaaaa
Sequence translation MRCLPVFIILPLLIPSAPSVDAQPMTEDDVPLASFHEQTL
QELWNKRPCCPLIPGCCR

References
Remigio,E.A. and Duda,T.F. Jr. (2008) Evolution of ecological specialization and venom of a predatory marine gastropod. Mol. Ecol. 17:1156-1162

Internal links
Proteins Encoded Lp5.4 precursor

External links
Ncbi
GenBank EF467315

Tools