Leo-O1, mRNA, partial sequence. (N01249) Nucleic Acid Card

General Information
Name Leo-O1, mRNA, partial sequence.
Organism Conus leopardus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
ccttgctcggtgaatttggcttcatatttctccactgtct
tctttggcatcgcctaaaatatcaccaag
atgaaactgac
gtgcatgatgctcgttgctgtgctgttcttgaccgcctgg
acatttgtcacagctaatgtctccagaaatggattggaga
atctttttccagaggaacgtcacgaaatgatgaaccccga
agccgctaaattgaacaatagagactgcgttaaagcgggt
acagcttgtggctttccgaaacctgaaccagcctgctgca
gttcctggtgcattttcgtctgcacc
taaaactgccgtga
tgccttctactcccctgtgtgctacctggcttgatctttg
attggcgcgtgcccttcactggttatgaaccccctctgat
ccgactctctggtggcctcaggggtcaaacatccaaataa
agcgacaacacaaaaaaaaaaa
Sequence translation MKLTCMMLVAVLFLTAWTFVTANVSRNGLENLFPEERHEM
MNPEAAKLNNRDCVKAGTACGFPKPEPACCSSWCIFVCT

References
Remigio,E.A. and Duda,T.F. Jr. (2008) Evolution of ecological specialization and venom of a predatory marine gastropod. Mol. Ecol. 17:1156-1162

Internal links
Proteins Encoded Leo-O1 precursor

External links
Ncbi
GenBank EF467316

Tools