Leo-O4 conotoxin, mRNA, partial sequence (N01252) Nucleic Acid Card

General Information
Name Leo-O4 conotoxin, mRNA, partial sequence
Organism Conus leopardus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
tgctcggtgaatttggcttcatatttctccactgtcttct
ttggcatcacctaaaacatcaccaag
atgaaactgacgtg
catgatgctcgttgctgtgctgttcttgaccgcctggaca
tttgtcacagctaatgtctccagaaatggattggagaatc
tttttccagaggaacgtcacgaaatgatgaaccccaatgc
cgctaaattgaacaatagagactgcgttaaagcgggtaca
gcttgtggctttccgaaacctgaaccagcctgctgcagtt
cctggtgcattttcgtctgcacc
taaaactgccgtgatgc
cttctactcccctgtgtgttacctgg
Sequence translation MKLTCMMLVAVLFLTAWTFVTANVSRNGLENLFPEERHEM
MNPNAAKLNNRDCVKAGTACGFPKPEPACCSSWCIFVCT

References
Remigio,E.A. and Duda,T.F. Jr. (2008) Evolution of ecological specialization and venom of a predatory marine gastropod. Mol. Ecol. 17:1156-1162

Internal links
Proteins Encoded Leo-O4 precursor

External links
Ncbi
GenBank EF467319

Tools