conomarphin precursor, mRNA, complete cds. (N01255) Nucleic Acid Card

General Information
Name conomarphin precursor, mRNA, complete cds.
Organism Conus marmoreus
Organism Diet molluscivorous
Organism Clade VI
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaagctgggagtcttgttgtgcatctttctgg
ttctgtttcccatggcaactcttcagctggatggagatca
aaccgctgatcgccatgcagaccaaaggggccaggaccta
acagaacagcaacgaaactcgaagcgtgttctgaagaaaa
gggattgggaataccatgcacatccaaaacccaatagctt
ctggacgcttgtt
tgagaggcatcaggctggttattccag
aacagtggtcgtctaatgattgaattaaaagttcactaca
gggaataaaagtttcccaaaaaaaaaaaaaaaaaaaaa
Sequence translation MMSKLGVLLCIFLVLFPMATLQLDGDQTADRHADQRGQDL
TEQQRNSKRVLKKRDWEYHAHPKPNSFWTLV

References
Han,Y., Huang,F., Jiang,H., Liu,L., Wang,Q., Wang,Y., Shao,X., Chi,C., Du,W. and Wang,C. (2008) Purification and structural characterization of a D-amino acid-containing conopeptide, conomarphin, from Conus marmoreus. FEBS J. 275:1976-1987

Internal links
Proteins Encoded conomarphin-Mr1 precursor

External links
Ncbi
GenBank EU048276

Tools