Conus californicus conotoxin CalTx 12.2.1E mRNA, partial cds. (N01256) Nucleic Acid Card

General Information
Name Conus californicus conotoxin CalTx 12.2.1E mRNA, partial cds.
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
cgtggcgtgtgcagcacgcccgaaggatcatgtgtccaca
acggatgcatatgtcagaacgcaccttgctgtcacgagtc
cggttgtaactgggccaatgtttgcccaggtttcttatgg
gacaaaaac
tga
Sequence translation RGVCSTPEGSCVHNGCICQNAPCCHESGCNWANVCPGFLW
DKN

References
Gilly,W.F., Richmond,T., Elliger,C.A., Lebaric,Z.N., Schulz,J., Bingham,J.P. and Sweedler,J.V. (0) Extreme Diversity in a Novel Family of Peptide Toxins from Conus californicus

Internal links
Proteins Encoded CalTx 12.2.1E

External links
Ncbi
GenBank EU284127

Tools