CalTx 12.2.1E precursor (N01256) Nucleic Acid Card

General Information
Name CalTx 12.2.1E precursor
Organism Conus californicus
Organism Diet piscivorous
Organism Clade Early
Organism Region Eastern Pacific
Notes

Sequence
cgtggcgtgtgcagcacgcccgaaggatcatgtgtccaca
acggatgcatatgtcagaacgcaccttgctgtcacgagtc
cggttgtaactgggccaatgtttgcccaggtttcttatgg
gacaaaaac
tga
Sequence translation RGVCSTPEGSCVHNGCICQNAPCCHESGCNWANVCPGFLW
DKN

References
Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., (2011) Gilly, W.F., Richmond, T.A., Duda, T.F., Elliger, C., Lebaric, Z., Schulz, J., Bingham, J.P. and Sweedler, J.V., 2011. A diverse family of novel peptide toxins from an unusual cone snail, Conus californicus Journal of Experimental Biology 214:147-161

Internal links
Proteins Encoded CalTx 12.2.1E

External links
Ncbi
GenBank EU284127

Tools