Conus virgo V1 superfamily conotoxin 15.1 precursor, mRNA, completecds. (N01257) Nucleic Acid Card

General Information
Name Conus virgo V1 superfamily conotoxin 15.1 precursor, mRNA, completecds.
Organism Conus virgo
Organism Diet vermivorous
Organism Clade XIII
Organism Region Indo-Pacific
Notes

Sequence
atgatgccagtcatcctcctgcttctgttgtccctggcaa
tccgttgtgccgacggaaaggcggtccaaggggacagtga
tcccagtgccagtcttctaacaggggacaagaatcatgat
ctacctgtcaagcgggattgcaccacttgtgctggtgaag
aatgctgtggcaggtgcacatgcccttggggggacaactg
ttcttgcatagagtgggggaaa
taa
Sequence translation MMPVILLLLLSLAIRCADGKAVQGDSDPSASLLTGDKNHD
LPVKRDCTTCAGEECCGRCTCPWGDNCSCIEWGK

References
Peng,C., Liu,L., Shao,X., Chi,C. and Wang,C. (2008) Identification of a novel class of conotoxins defined as V-conotoxins with a unique cysteine pattern and signal peptide sequence. Peptides 29:985-991

Internal links
Proteins Encoded ViXVA precursor

External links
Ncbi
GenBank EU169206

Tools