Conus vitulinus V1 superfamily conotoxin 15.1 precursor, mRNA,complete cds. (N01258) Nucleic Acid Card

General Information
Name Conus vitulinus V1 superfamily conotoxin 15.1 precursor, mRNA,complete cds.
Organism Conus vitulinus
Organism Diet vermivorous
Organism Clade
Organism Region Indo-Pacific
Notes

Sequence
atgatgccagtcatcctcccgcttctgttgtccctggcaa
tccgtggtggtgacggacaggcgatccaaggggacagaga
cctcattgcgaaactttttaaaagataccaggaacatggt
ctatcagtcaagagggcttgccatacttgcgatgatggta
cagaatgctgtgattcaagatgcagctgcccttggaatac
ttgtacatgcataccgtgggggaaa
taa
Sequence translation MMPVILPLLLSLAIRGGDGQAIQGDRDLIAKLFKRYQEHG
LSVKRACHTCDDGTECCDSRCSCPWNTCTCIPWGK

References
Peng,C., Liu,L., Shao,X., Chi,C. and Wang,C. (2008) Identification of a novel class of conotoxins defined as V-conotoxins with a unique cysteine pattern and signal peptide sequence. Peptides 29:985-991

Internal links
Proteins Encoded Vt15.1 precursor

External links
Ncbi
GenBank EU169207

Tools