Conus textile S-superfamily conotoxin 8.1 mRNA, partial cds. (N01261) Nucleic Acid Card

General Information
Name Conus textile S-superfamily conotoxin 8.1 mRNA, partial cds.
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
ttgaaaatgggagctatgtttgtccttttgcttcttttca
ccctggcatccagccaccgggaaggagatatccaggcaag
gaaaacacacctgaagagcgacttctatcgtactctgcca
aggtttgccagaggatgcactatctcttgtggatatgaag
acaacaggtgtcagggtgaatgccactgccccggaaaaac
caattgttactgtaccagtggccatcataacaaaggatgc
ggttgtgcatgt
Sequence translation LKMGAMFVLLLLFTLASSHREGDIQARKTHLKSDFYRTLP
RFARGCTISCGYEDNRCQGECHCPGKTNCYCTSGHHNKGC
GCAC

References
Liu,L., Wu,X., Yuan,D., Chi,C. and Wang,C. (2008) Identification of a novel S-superfamily conotoxin from vermivorous Conus caracteristicus. Toxicon 51:1331-1337

Internal links
Proteins Encoded Tx8.1 precursor

External links
Ncbi
GenBank EU496106

Tools