Conus caracteristicus Ca8b mRNA, partial cds. (N01263) Nucleic Acid Card

General Information
Name Conus caracteristicus Ca8b mRNA, partial cds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgatgttgaaaatgggagctatgtttgtccttttgcttc
ttttcatcctgccatccagccagcaggaaggagatgtcca
ggcaagaaaaacgcacctgaagagaggcttctacggtact
ctggcaatgtctaccagaggatgctctggcacttgccatc
gtcgtgaggacggcaagtgtcggggtacttgcgactgctc
cggatacagctattgtcgctgcggtgacgctcaccatttt
taccgaggatgcacgtgttcatgtcaaggt
Sequence translation MMLKMGAMFVLLLLFILPSSQQEGDVQARKTHLKRGFYGT
LAMSTRGCSGTCHRREDGKCRGTCDCSGYSYCRCGDAHHF
YRGCTCSCQG

References
Liu,L., Wu,X., Yuan,D., Chi,C. and Wang,C. (2008) Identification of a novel S-superfamily conotoxin from vermivorous Conus caracteristicus. Toxicon 51:1331-1337

Internal links
Proteins Encoded Ca8b precursor

External links
Ncbi
GenBank EU516350

Tools