Ca8a, mRNA,partial cds (N01264) Nucleic Acid Card

General Information
Name Ca8a, mRNA,partial cds
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
gagactgcttcaacaattgtaaccatctaagcaagacgtg
acgtgcaggagaggaagaacgagtc
atgatgttgaaaatg
ggagctatgtttgtccttttgcttcttttcatcctgccat
ccagccagcaggaaggagatgtccaggcaagaaaaacgca
cctgaagagaggcttctacggtactctggcaatgtctacc
agaggatgctctggcacttgccatcgtcgtgaggacggca
agtgtcggggtacttgcgactgctccggatacagctattg
tcgctgcggtgacgcacaccatttctatcgaggatgcacg
tgtacatgtta
aggttgatcttttaactcgttgaacgatt
aaaaaaaaaattttagagcaatatgttacagaaaaaccga
agactctgagacttctcgtaataaatccgtaaagacatta
aaaaaaaaaaaaaaaaa
Sequence translation MMLKMGAMFVLLLLFILPSSQQEGDVQARKTHLKRGFYGT
LAMSTRGCSGTCHRREDGKCRGTCDCSGYSYCRCGDAHHF
YRGCTCTC?

References
Liu, L., Chi, C.W. and Wang, C.G. (0) cDNA of S-superfamily conotoxin precursor from Conus caracteristicus Unpublished

Internal links
Proteins Encoded Ca8a precursor

External links
Ncbi
GenBank EF208032

Tools