Conus caracteristicus V-superfamily conotoxin Ca15a mRNA, partialcds. (N01265) Nucleic Acid Card

General Information
Name Conus caracteristicus V-superfamily conotoxin Ca15a mRNA, partialcds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
aaatgtcctcatacggtatgctgcgaccggtctaggtgtt
cgtgcaaactaatacggacgcgacctcttatgtaccatgt
gtgtgtttgc
Sequence translation KCPHTVCCDRSRCSCKLIRTRPLMYHVCVC

References
Liu,L., Wu,X., Yuan,D., Chi,C. and Wang,C. (2008) Identification of a novel S-superfamily conotoxin from vermivorous Conus caracteristicus. Toxicon 51:1331-1337

Internal links
Proteins Encoded Ca15a

External links
Ncbi
GenBank EU547208

Tools