O-Superfamily Conotoxin Peptides. (N01336) Nucleic Acid Card

General Information
Name O-Superfamily Conotoxin Peptides.
Organism Conus gloriamaris
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgaaactgacgtgcatgatgatcgttgctgtgctgttcc
tgacagcctggacgctagtcatggctgatgactccaacaa
tggactggcgaatcttttttcgaaatcacgtgacgaaatg
gaggaccccgaagcttctaaattggagaaaagggattgcc
aagcactatgggattattgtccagtaccgctcttgtcatc
gggtgattgctgctatggcttaatctgtggccctttcgtc
tgcattggatgg
tgatgtcttctactcccatc
Sequence translation MKLTCMMIVAVLFLTAWTLVMADDSNNGLANLFSKSRDEM
EDPEASKLEKRDCQALWDYCPVPLLSSGDCCYGLICGPFV
CIGW

References
Hillyard, D.R., Mcintosh, M.J., Jones, R.M., Cartier, E.G., Watkins, M., Olivera, B.M. and Layer, R.T. (2003) O-Superfamily Conotoxin Peptides Patent: JP 2003533178-A 1 11-NOV-2003;

Internal links
Proteins Encoded Gm6.5 precursor

External links
Ncbi
GenBank DJ379453

Tools