O-Superfamily Conotoxin Peptides. (N01338) Nucleic Acid Card

General Information
Name O-Superfamily Conotoxin Peptides.
Organism Conus dalli
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Pacific
Notes

Sequence
atgaaactgacgtgtgtgatgatcgttgctgtgctgttcc
tgacagcctggacgctagtcatggctgatgactccaacaa
tggactggcgaatcttttttcgaaattacgtgacgaaatg
gaggaccccgaaggttctaaattggagaaaaaggattgcc
aagaaaaatgggattattgtccagtaccgttcttgggatc
gaggtattgctgcgatggctttatctgtccatctttcttc
tgcgct
tgatagtgatgtcttctctattcccctc
Sequence translation MKLTCVMIVAVLFLTAWTLVMADDSNNGLANLFSKLRDEM
EDPEGSKLEKKDCQEKWDYCPVPFLGSRYCCDGFICPSFF
CA

References
Hillyard, D.R., Mcintosh, M.J., Jones, R.M., Cartier, E.G., Watkins, M., Olivera, B.M. and Layer, R.T. (2003) O-Superfamily Conotoxin Peptides Patent: JP 2003533178-A 1 11-NOV-2003;

Internal links
Proteins Encoded Da6.6 precursor

External links
Ncbi
GenBank DJ379455

Tools