Conus ventricosus clone VnMKLT1-012 conotoxin scaffold VI/VII precursor, mRNA, complete cds (N00134) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMKLT1-012 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
cccagaacatcaccaag
atgaaactgacgtgcatgatgat
cgttgctgtgctgttcttgaccgcctggacattcgtcacg
gccgatgactccagaaatggattggattatctttttccga
aggcacgtcacgaaatgaaccccaaagcctctagagacat
caagaggtgccgtcctggtggcatgatttgtggctttccg
aaacctggaccatactgctgcagtggctggtgctttgtcg
tctgcttg
taaaactgtcgtgatgtcttctactctccttt
gtgccacctggcttgatctttgattggcgcgtgcccttcg
ctgattatgaacccctctgatccgactctctggaggcctc
gggggttcaacat
Sequence translation MKLTCMMIVAVLFLTAWTFVTADDSRNGLDYLFPKARHEM
NPKASRDIKRCRPGGMICGFPKPGPYCCSGWCFVVCL

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Vn6.10 precursor

External links
Ncbi
GenBank AF215034

Tools