Conus textile spasmodic peptide tx9a mRNA, complete cds (N00014) Nucleic Acid Card

General Information
Name Conus textile spasmodic peptide tx9a mRNA, complete cds
Organism Conus textile (Cloth-of-gold cone)
Organism Diet molluscivorous
Organism Clade V
Organism Region Indo-Pacific
Notes

Sequence
atgcatctgtcactggcacgctcagctgttttgatgttgc
ttctgctgtttgccttgggcaactttgttgtggtccagtc
aggacagataacaagagatgtggacaatggacagctcaca
gacaaccgccgtaacctgcaatcgaagtggaagccagtga
gtctctacatgtcacgacggggttgtaacaattcttgcca
ggagcattccgattgcgaatcccattgtatttgcacgttt
agaggatgcggagctgttaatggttga
Sequence translation MHLSLARSAVLMLLLLFALGNFVVVQSGQITRDVDNGQLT
DNRRNLQSKWKPVSLYMSRRGCNNSCQEHSDCESHCICTF
RGCGAVNG-

References
Miles,L.A., Dy,C.Y., Nielsen,J., Barnham,K.J., Hinds,M.G., Olivera,B.M., Bulaj,G. and Norton,R.S. (2002) Structure of a Novel P-superfamily Spasmodic Conotoxin Reveals an Inhibitory Cystine Knot Motif J. Biol. Chem. 277:43033-43040
Lirazan,M.B., Hooper,D., Corpuz,G.P., Ramilo,C.A., Bandyopadhyay,P., Cruz,L.J. and Olivera,B.M. (2000) The spasmodic peptide defines a new conotoxin superfamily Biochemistry 39:1583-1588

Internal links
Proteins Encoded TxIXA

External links
Ncbi
GenBank AF193510

Tools