Conus ventricosus clone VnMKLT2-0222 conotoxin scaffold VI/VII precursor, mRNA, complete cds (N00141) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMKLT2-0222 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
tagcttcagaattcttcaccgtcttctttgcacaaccaaa
aacatcagcaag
atgaaactgacgtgcgtgttgatcgtcg
ccgtgctgttcctgacggcctgtcaactcactacagctgc
gagttacgccagaagtgagcggcagcatcctgatctgggg
tcgagcgaccaaaactccaagttaaccaagagatgcctag
caagtggtgaaacatgttggcgtgatacgtcctgctgcag
cttttcgtgcaccaacaacgtctgcttc
taaagctggtct
ggcgtctgacacttccccttctgtgctctatcctcat
Sequence translation MKLTCVLIVAVLFLTACQLTTAASYARSERQHPDLGSSDQ
NSKLTKRCLASGETCWRDTSCCSFSCTNNVCF

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Vn6.14 precursor

External links
Ncbi
GenBank AF215041

Tools