Conus ventricosus clone VnMKLT2-013 conotoxin scaffold VI/VII precursor, mRNA, complete cds (N00145) Nucleic Acid Card

General Information
Name Conus ventricosus clone VnMKLT2-013 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Organism Conus ventricosus
Organism Diet molluscivorous
Organism Clade
Organism Region Eastern Atlantic and Mediterranean
Notes

Sequence
gagcttcagaattcttcagtcttatttgcactaccaaaac
atcagc
atgatgaaactgacgtgcgtgttgatcatcgccg
tgctgttcctgacggcctgtcaactcactacagctgagac
tagagatgagtaccgtgcagtgaggtcgagcgacgaagtg
cagaattccaggtcgaccgacgattgctcgacagcaggtt
gtaaaaatgtcccttgctgcgagggtttggtttgcactgg
ccccagtcaaggacccgtatgccagcctcttgcc
taattc
gtccatgc
Sequence translation MMKLTCVLIIAVLFLTACQLTTAETRDEYRAVRSSDEVQN
SRSTDDCSTAGCKNVPCCEGLVCTGPSQGPVCQPLA

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Vn6.18 precursor

External links
Ncbi
GenBank AF215045

Tools