Conus caracteristicus tau conotoxin 5.1 mRNA, complete cds. (N01539) Nucleic Acid Card

General Information
Name Conus caracteristicus tau conotoxin 5.1 mRNA, complete cds.
Organism Conus caracteristicus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
atgcgctgtgtcccagtcttcatcatccttcttctgttgg
cttctcctgcagcttcagaccctctggaaaagagaatcca
aagcgatttgattcgtgcagcccttgaagacgccgatacg
aaaaacgacccacggattcttgaggatatagtctccaccg
ctctcgctacttgctgcaaatttcagtttttgaatttttg
ctgtaatgagaaa
taa
Sequence translation MRCVPVFIILLLLASPAASDPLEKRIQSDLIRAALEDADT
KNDPRILEDIVSTALATCCKFQFLNFCCNEK

References
Peng, C., Wu, X., Han, Y., Yuan, D., Chi, C. and Wang, C. (0) Identification of six novel T-1 conotoxins from the venom ducts of Conus pulicarius by molecular cloning Unpublished

Internal links
Proteins Encoded Ca5.1 precursor

External links
Ncbi
GenBank EU090172

Tools