Conus arenatus clone ArMKLT2-0322 conotoxin scaffold VI/VII precursor, mRNA, complete cds (N00154) Nucleic Acid Card

General Information
Name Conus arenatus clone ArMKLT2-0322 conotoxin scaffold VI/VII precursor, mRNA, complete cds
Organism Conus arenatus
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
ttccacggtgaacctgacttcatatttcttcactctcttc
tttggcatcaccaacatcatcagcaga
atgaaactgacgt
gcgtgttgatcatcgccgtgctgttccttattgtctgtca
gctcaatacagctgatgactccagagataagcaggagtac
cgtgcagtgaggttgagagacgcaatacggaattccagag
gttccaggtcgtgcgggaacctaggtgaaagctgttctgc
tcaccgttgctgccctggtctgatgtgcatgggcgaggcn
agcatttgcatcccgtac
tagtctggcatctgatatttct
cctctgngctctaccctcttttgcctgattcacccatatt
tatgtgtggtnatgaaccactctgtacctacntttctggt
ggcttctgaggac
Sequence translation MKLTCVLIIAVLFLIVCQLNTADDSRDKQEYRAVRLRDAI
RNSRGSRSCGNLGESCSAHRCCPGLMCMGE?SICIPY

References
Conticello,S.G., Gilad,Y., Avidan,N., Ben-Asher,E., Levy,Z. and Fainzilber,M. (2001) Mechanisms for evolving hypervariability: the case of conopeptides Mol. Biol. Evol. 18:120-131

Internal links
Proteins Encoded Ar6.12 precursor

External links
Ncbi
GenBank AF215054

Tools