Sr5.4 precursor, mRNA,complete cds (N01547) Nucleic Acid Card

General Information
Name Sr5.4 precursor, mRNA,complete cds
Organism Conus spurius
Organism Diet vermivorous
Organism Clade
Organism Region Western Atlantic and Caribbean
Notes

Sequence
cacattctttttcacctgggacacgggaagctgactagaa
gcaga
atgcgctgtctcccagtcttcgtcattcttctgct
gctgattgcatctgcacctagcgttgatgcccaactgaag
accaaagatgatgtgcccctggcatctttccatgataatg
caaagggaacccaacacaaacggatcattaactggtgctg
cttagtattctatcagtgctgt
taatccagggtaaaggga
aatgactttggatgagacccctgcgaattgtccctggatg
tgagatttggaaagcagactgttcctttcgcgcgtgttcg
tgggatttcaaacagtcgttaacaacacgctgccacttgc
aagctacaatctttttgtcctttgatctgtggaactggat
gatcaaacaactgaaatgtcatagaatttcttcaatgggt
atacactatgactgtgtagtcagtaattacatcatttgga
ctttttgaaatatttttcaaaatgtaagtttttttccccc
ttggaaaggtcctttgtagtaatcgaattc
Sequence translation MRCLPVFVILLLLIASAPSVDAQLKTKDDVPLASFHDNAK
GTQHKRIINWCCLVFYQCC

References
Zamora-Bustillos,R., Aguilar,M.B., Falcón,A. and Heimer de la Cotera,E.P. (2009) Identification, by RT-PCR, of four novel T-1-superfamily conotoxins from the vermivorous snail Conus spurius from the Gulf of Mexico. Peptides 30:1396-1404

Internal links
Proteins Encoded Sr5.4 precursor

External links
Ncbi
GenBank FJ646605

Tools