SrVA precursor, mRNA,complete cds. (N01550) Nucleic Acid Card

General Information
Name SrVA precursor, mRNA,complete cds.
Organism Conus spurius
Organism Diet vermivorous
Organism Clade
Organism Region Western Atlantic and Caribbean
Notes

Sequence
gaagctgactagaagcaga
atgcgctgtctcccagtcttc
gtcattcttctgctgctgattgcatctgcacctagcgttg
atgcccaactgaagaccaaagatgatgtgcccctggcatc
tttccatgataatgcaaagggaacccaacacaaacggatc
attaactggtgctgcttaatattctatcagtgctgt
taat
ccaggataaagggaaatgactttggatgagacccctgcga
attgtccctggatgtgagatttggaaagcagactgttcct
ttcgcgcgtgttcgtgggatttcaaacagtcgttaacaac
acgctgccacttgcaagctacaatctttttgtcctttgat
ctgtggaactggatgatcaaacaactgaaatgtcatagaa
tttcttcaatgggtatacactatgactgtgtagtcagtaa
ttacatcatttggactttttgaaatatttttcaaaatgta
agtttttttcccccttggaaaggtcctttgtagttaaata
tttcagtatgttatgctttgcacacaagttatagaatgtt
gtctttctttttgttcccgcatcaatggtgggggcagaaa
ttattggttttggtcaatgtaattatgacctgcgtttagt
gctatagtgattccattttcagcgttgaatgtttcatctg
caaaccgaaagtgattgatcgactaataaagacttgcatg
gc
Sequence translation MRCLPVFVILLLLIASAPSVDAQLKTKDDVPLASFHDNAK
GTQHKRIINWCCLIFYQCC

References
Zamora-Bustillos,R., Aguilar,M.B., Falcón,A. and Heimer de la Cotera,E.P. (2009) Identification, by RT-PCR, of four novel T-1-superfamily conotoxins from the vermivorous snail Conus spurius from the Gulf of Mexico. Peptides 30:1396-1404

Internal links
Proteins Encoded SrVA precursor

External links
Ncbi
GenBank FJ646602

Tools