BuIIIA mRNA, complete cds. (N01553) Nucleic Acid Card

General Information
Name BuIIIA mRNA, complete cds.
Organism Conus bullatus
Organism Diet piscivorous
Organism Clade I
Organism Region Indo-Pacific
Notes

Sequence
atgatgtctaaactgggagtcttgttgaccatctgtctgc
ttctgtttcccctttttgctcttccgcaggatggagatca
acctgcagaccgacctgcagagcgtatgcaggacgacatt
tcatctgagcagaattccttgcttgagaagagagttactg
acaggtgctgcaaagggaagagggaatgcggcagatggtg
cagagatcactcgcgttgttgcggtcgacga
taagctgtt
gatgaccagctttgttatcacggctacatcaagtgtctag
t
Sequence translation MMSKLGVLLTICLLLFPLFALPQDGDQPADRPAERMQDDI
SSEQNSLLEKRVTDRCCKGKRECGRWCRDHSRCCGRR

References
Holford,M., Zhang,M.M., Gowd,K.H., Azam,L., Green,B.R., Watkins,M., Ownby,J.P., Yoshikami,D., Bulaj,G. and Olivera,B.M. (2009) Pruning nature: Biodiversity-derived discovery of novel sodium channel blocking conotoxins from Conus bullatus. Toxicon 53:90-98

Internal links
Proteins Encoded BuIIIA precursor

External links
Ncbi
GenBank FJ240165

Tools