Ml20.1 gene precursor, mRNA (N01556) Nucleic Acid Card

General Information
Name Ml20.1 gene precursor, mRNA
Organism Conus miles
Organism Diet vermivorous
Organism Clade XII
Organism Region Indo-Pacific
Notes

Sequence
atgccaaaactggaaatgatgctgctggttctgctgattt
tgcccctgtcctcttttagtgcggcaggtgaacaagtggt
acaaggggaccggcgtagcgatggactggctcgttacctc
caacgtggtggcagagacgttcaggagtgtcaagttgtta
ctccaggctcaaaatggggaaggtgctgcctgaatcgggt
ctgcggtcccatgtgctgccctgcaagccattgctactgc
atctatcatcggggaaagggccacgggtgttcctgc
tga
Sequence translation MPKLEMMLLVLLILPLSSFSAAGEQVVQGDRRSDGLARYL
QRGGRDVQECQVVTPGSKWGRCCLNRVCGPMCCPASHCYC
IYHRGKGHGCSC

References
Loughnan,M.L., Nicke,A., Lawrence,N. and Lewis,R.J. (2009) Novel alphaD-conopeptides and their precursors identified by cDNA cloning define the D-conotoxin superfamily. Biochemistry 48:3717-3729

Internal links
Proteins Encoded Ml20.1 precursor

External links
Ncbi
GenBank FN178636

Tools