MIL3-f1 allele, mRNA, partial cds (N01561) Nucleic Acid Card

General Information
Name MIL3-f1 allele, mRNA, partial cds
Organism Conus miliaris
Organism Diet vermivorous
Organism Clade XI
Organism Region Indo-Pacific
Notes

Sequence
c
gtgttgatcatcgccgtgctgttcctgacggcctgtcaa
ctcactacagctgagactgcctccagaggtaagccgaagc
accgtgctctgaggtcaactgacaaaaactccaggatgac
caggggttgcacgcatcccggtggagcctgtggcggtcat
catcactgctgcagcctgttttgcaataccgcggccaatg
catgtaat
taaagctggtctggcgtctgatattccccttc
cgtgatctatcctcttttg
Sequence translation VLIIAVLFLTACQLTTAETASRGKPKHRALRSTDKNSRMT
RGCTHPGGACGGHHHCCSLFCNTAANACN

References
Duda,T.F. Jr. and Lee,T. (2009) Ecological release and venom evolution of a predatory marine snail at Easter Island. PLoS ONE 4

Internal links
Proteins Encoded Ml3-f1 precursor

External links
Ncbi
GenBank FJ716824

Tools