Ca11a, cDNA, full length (N01588) Nucleic Acid Card

General Information
Name Ca11a, cDNA, full length
Organism Conus caracteristicus (characteristic cone)
Organism Diet vermivorous
Organism Clade XIV
Organism Region Indo-Pacific
Notes

Sequence
gagtcaccaagagagggcttcagacgtgggcattccagct
gtcaacattctgcagccttgcttgtaaatcccgatctgag
aagggggcaaaacgttccggggatcatc
atgaagctggtt
ttggccatcgttgttattctgatgcttctgtccttaagca
ccggagcagagatgtctgacaaccatgcaagcaggagtgc
cactgcacggagagacaggcatcttagtccaaaggcatgg
ccatgcggaggggtgcgtgcgagctgcagccgtcatgacg
attgctgtggatcgctctgttgtttcggaacgtccactgg
atgccgtgttgcagtcaggccgtgctgg
tgaatttctgtc
atctgggagggcgcagttctggcacgcttgtgcatcctca
tttgcagcagcctgctgccaaatcgaattcgcatagtgtc
aacatttgttgattaaagccaaatggcgtagaaaaaaaaa
aaaaaaaaaaaaaaaaaaaaaa
Sequence translation MKLVLAIVVILMLLSLSTGAEMSDNHASRSATARRDRHLS
PKAWPCGGVRASCSRHDDCCGSLCCFGTSTGCRVAVRPCW

References
Yuan,D.D., Liu,L., Shao,X.X., Peng,C., Chi,C.W. and Guo,Z.Y. (2009) New conotoxins define the novel I3-superfamily. Peptides 30:861-865

Internal links
Proteins Encoded Ca11A precursor

External links
Ncbi
GenBank

Tools